We use cookies to offer you the best experience on our site. You can find out more about the cookies we use or disable them in the Cookie settings
Products
781 - 800 of 2126
Corticotropin Releasing Factor, CRF, human, rat - 1 mg
- SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
- Cat.Number : AS-24254
Corticotropin Releasing Factor, CRF, ovine - 0.5 mg
- SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
- Cat.Number : AS-22932
Covid19 Spike Peptide library - 96well format - 159 peptides - 1 library
- Cat.Number : EG-COV19-LIB1
781 - 800 of 2126