Products
961 - 980 of 2126
EDANS, acid [5-((2-Aminoethyl)amino)naphthalene-1-sulfonic acid] - 1 g
- Cat.Number : AS-23887
EDANS, sodium salt [5-[(2-aminoethyl)amino]naphthalene-1-sulfonic acid, sodium salt] - 0.5 g
- Cat.Number : AS-23886
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], 5-FAM labeled - 5 mg
- 5-FAM-DADE-pY-LIPQQG
- Cat.Number : AS-29971-5
EGF Receptor Substrate 2 [DADE-pY-LIPQQG], Biotinylated - 1 mg
- Biotin-DADE-pY-LIPQQG
- Cat.Number : AS-29972-1
EGFR Protein Tyrosine Kinase Substrate [ADEYLIPQQ] - 1 mg
- ADEYLIPQQ
- Cat.Number : AS-29942-1
Elafin - 0.1 mg
- AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
- Cat.Number : AS-61641
Elastase Substrate, fluorogenic, (Z-AAAA)2Rh110 - 5 mg
- (Z-AAAA)2Rh110
- Cat.Number : AS-60321-5
Elastase/Trypsin Substrate, fluorogenic, (Z-AR)2Rh110•2HCl - 5 mg
- (Z-AR)2Rh110•2HCl
- Cat.Number : AS-60322-5
961 - 980 of 2126