Peptides

HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg

193.00
Check your price
  • Cat.Number : AS-60743
  • Availability :
    In production

Alternative choices

Quantity

Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.

Specifications

Chemistry
Sequence one letter code
  • ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
Sequence three letter code
  • H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (Disulfide bridge: 2-30, 4-19, 9-29)
CAS registry number
  • 136661-76-2
Molecular Formula
  • C150H222N44O38S6
Molecular Mass/ Weight
  • 3442.1
Modification
Conjugation
  • Unconjugated
Quantity & Purity
Purity
  • ≥ 95%
Storage & stability
Form
  • Lyophilized
Activity
Biomarker Target
Research Area
Sub-category Research Area
Usage
  • Research use
Source
Source / Species
  • human
Codes
Code Nacres
  • NA.26

You may also be interested in the following product(s)

Tube of hBD-1 peptide, ?-Defensin-1 peptide, human

hBD-1, b-Defensin-1, human - 0.1 mg

Cat.Number : AS-60740
294.00 Excl. Tax
Tube of hBD-3 peptide, ?-Defensin-3 peptide, human

hBD-3, b-Defensin-3, human - 0.1 mg

Cat.Number : AS-60741
294.00 Excl. Tax

Citations

Cationic antimicrobial peptides disrupt the Streptococcus pyogenes ExPortal

Mol Microbiol . 2012 Jul 11 ; 85(6) 1119 | DOI : 10.1111/j.1365-2958.2012.08163.x

  • LA. Vega
  • et al

Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides.

Microbiology. . 2009 Jun 18 ; 155(Pt9) 2818 | DOI : 10.1099/mic.0.028969-0

  • C. Kooi
  • PA. Sokol

Candida albicans Mucin Msb2 Is a Broad-Range Protectant against Antimicrobial Peptides

Antimicrob Agents Chemother . 2013 Aug 01 ; 57(8) 3917 | DOI : 10.1128/AAC.00862-13

  • M. Swidergall
  • et al

Candida albicans mucin Msb2 Is a broad-tange protectant against antimicrobial peptides.

Antimicrob Agents Chemother . 2013 Aug 01 ; 57(8) 3917 | DOI : 10.1128/AAC.00862-13.

  • M. Swidergall
  • et al

Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37

Infect Immun . 2015 Sep 28 ; 83(12) 4701 | DOI : 10.1128/IAI.00746-15

  • S. Hou
  • et al

Strategies for the identification of arginine ADP-ribosylation sites.

J Proteomics . 2011 Dec 10 ; 75(1) 169 | DOI : https://doi.org/10.1016/j.jprot.2011.07.003

  • S. Laing
  • et al