We use cookies to offer you the best experience on our site. You can find out more about the cookies we use or disable them in the Cookie settings
Catalog
681 - 700 of 1072
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg
- ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
- Cat.Number : AS-60743
HNP-2, a-Defensin-2, Human Neutrophil Peptide-2 - 0.1 mg
- CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
- Cat.Number : AS-60744
Hyaluronan-Binding Peptide, biotin labeled - 1 mg
- GAHWQFNALTVRGGGS-K(Biotin)
- Cat.Number : AS-65199
681 - 700 of 1072