We use cookies to offer you the best experience on our site. You can find out more about the cookies we use or disable them in the Cookie settings
Products
1181 - 1200 of 2126
Histone H4 (8-30)-WGK(Biotin) - 1 mg
- Ac-KGLGKGGAKRHRKVLRDNIQGIT-WGK(biotin)
- Cat.Number : AS-65417-1
HIV Substrate, HiLyte™ Fluor 488 - 0.1 mg
- QXL®520-GABA-SQNYPIVQ-K(HiLyte™ Fluor 488)-NH2
- Cat.Number : AS-60635
HL647-T10 Calibration Oligo - 5 nmol
- 5' HiLyte™ Fluor 647 - TTT-TTT-TTT-T 3'
- Cat.Number : UN-CT030-005
HNP-1, a-Defensin-1, Human Neutrophil Peptide-1 - 0.1 mg
- ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
- Cat.Number : AS-60743
HNP-2, a-Defensin-2, Human Neutrophil Peptide-2 - 0.1 mg
- CYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 1-29, 3-18, 8-28)
- Cat.Number : AS-60744
1181 - 1200 of 2126